PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012714-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 394aa    MW: 45256.8 Da    PI: 9.8911
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012714-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++++++mg  + R +k+c +rw +yl
    NNU_012714-RA  4 RQRWQPEEDALLRAYVKQYGPKEWHLVSQRMGkpLDRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding35.71.9e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l + + +++G++ Wk+Ia++++ gRt+k +  +w  +
    NNU_012714-RA  59 KGSLTPEEQNLVISLQAKYGNK-WKKIASEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.664157IPR017930Myb domain
SMARTSM007172.0E-13355IPR001005SANT/Myb domain
SuperFamilySSF466896.97E-22498IPR009057Homeodomain-like
CDDcd001672.18E-8653No hitNo description
Gene3DG3DSA:1.10.10.601.7E-20660IPR009057Homeodomain-like
PfamPF139211.2E-13768No hitNo description
SMARTSM007172.6E-1058106IPR001005SANT/Myb domain
PROSITE profilePS5129418.33958108IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-1661107IPR009057Homeodomain-like
CDDcd001672.28E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MKERQRWQPE EDALLRAYVK QYGPKEWHLV SQRMGKPLDR DAKSCLERWK NYLKPGIKKG  60
SLTPEEQNLV ISLQAKYGNK WKKIASEVPG RTAKRLGKWW EVFKEKQLKL QQQKQQKTQQ  120
QQRLLPSDHP DPSAPSPTPP PTTTPERSLH GQYDHILETF AEKYVQPKLL KLHQQQPQPS  180
LLPSSLLMPS HLPLPEAPPI LSLATTTSST TAVLPAWMNN PNMVSSTSSL SSSSSATPSP  240
SVSLSLSPSE PTGLDSVSQE MGLTHQRFFT VHQMGTLVQY CKELEEGRQS WLQHKKEATW  300
RLTRLEQQLE SEKARKRREK MEEVEAKIRS LREEEMAYLD KIENECREQL NAIQRDADAK  360
EAKMVELWSS KHVKLAKLVE QMGIHSFPLT KDLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-14792789MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-1479230112MYB TRANSFORMING PROTEIN
1mse_C2e-14792789C-Myb DNA-Binding Domain
1msf_C2e-14792789C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1314319RKRREK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265247.10.0PREDICTED: protein rough sheath 2 homolog
SwissprotQ9S7B22e-97RS2_MAIZE; Protein rough sheath 2
TrEMBLA0A068U2N01e-166A0A068U2N0_COFCA; Uncharacterized protein
STRINGVIT_14s0083g00120.t011e-156(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.18e-60MYB family protein